SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1IHR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1IHR6
Domain Number 1 Region: 16-84
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 7.98e-28
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00021
Further Details:      
 
Domain Number 2 Region: 143-194
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000103
Family AraC type transcriptional activator 0.019
Further Details:      
 
Domain Number 3 Region: 91-140
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000582
Family AraC type transcriptional activator 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J1IHR6
Sequence length 200
Comment (tr|A0A0J1IHR6|A0A0J1IHR6_BACCI) Uncharacterized protein {ECO:0000313|EMBL:KLV25533.1} KW=Complete proteome; Reference proteome OX=1397 OS=Bacillus circulans. GN=ABW02_15315 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MTSNSIIIKECILVESYQWEAIHLNDPTYDGEFYYALKSTGTFCRPSCPSRTPNKKNVQI
YYDAKEALNDGYRACKRCQPDILNWKGSRYELVKQVETYILQHYDEKLTLNHISTALSIN
SHHLHRTFKLVTGSTPLQFSHQVRIEKAKELLTTSSLSATHISFKVGYSSLSHFSKVFKD
KEHISPSSFRNHIYRNSSKQ
Download sequence
Identical sequences A0A0J1IHR6
WP_047943175.1.65649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]