SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J1LTR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1LTR0
Domain Number 1 Region: 160-345
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.05e-57
Family Methylesterase CheB, C-terminal domain 0.0000431
Further Details:      
 
Domain Number 2 Region: 4-127
Classification Level Classification E-value
Superfamily CheY-like 0.0000000137
Family CheY-related 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J1LTR0
Sequence length 355
Comment (tr|A0A0J1LTR0|A0A0J1LTR0_9ENTR) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=1686381 OS=Citrobacter sp. MGH106. GN=SK36_00517 OC=Enterobacteriaceae; Citrobacter; Citrobacter freundii complex.
Sequence
MNSDNIRVLILDLGSVSRNDLVKQLEDHLHIKVVGQSAHRRQAIRLLQQLMPDLLILTLE
NSTADNVEVVETIMATRAIPILVMRFGAENNGDEDYISRGALAVLHQRSDAPLSTNALHR
KVELLVGVKVIRHIKGLRHPTEPIIPVIHPVMDAIKTTADWPFVLAIACSTGGPQALSKL
LQDLPGTFPCPVLIAQHIADGFAKNMVHWLDSVTDLKVRLAQEDDRVEAGYVYVLPPEQH
LIVKSDQRLAAIPRQDSDVYHPSCNLLLESVAEVFGEKAVGLIMTGMGSDGCRGIELIFQ
RGGRTLAQDEESSVVFGMNKNAIDKQLIHRTIPLDGLAKVLLSMAFHGHFESQLP
Download sequence
Identical sequences A0A0J1LTR0
WP_048220678.1.94094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]