SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6BU25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6BU25
Domain Number 1 Region: 3-242
Classification Level Classification E-value
Superfamily ThiG-like 6.67e-79
Family ThiG-like 0.0000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6BU25
Sequence length 257
Comment (tr|A0A0J6BU25|A0A0J6BU25_BREBE) Thiazole synthase {ECO:0000256|HAMAP-Rule:MF_00443, ECO:0000256|SAAS:SAAS00958550} KW=Complete proteome OX=1393 OS=Brevibacillus brevis (Bacillus brevis). GN=AB432_11985 OC=Brevibacillus.
Sequence
MMDTLKIGPYEFRSRLLLGTGKFADLDTQGKAVEVSEAEILTFAIRRLNLENPQEPNFLE
QLDLKKFTLLPNTAGAYTAEEAVRIARLAKASGLCDMIKVEVIGDPKTLLPDPIGTLEAS
KILVEEGFIVLTYTNDDPILARHLQEVGVHAVMPGASPIGSGQGIVNENNLRFIIEDAKV
PIIVDAGIGSPADCAKAMELGADGVLLNTAVALADNPVLMAEAMKLGVEAGRKGFLAGRI
AKKRYASASSPTEGMIE
Download sequence
Identical sequences A0A0J6BU25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]