SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6ELH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J6ELH2
Domain Number - Region: 33-74
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0589
Family Surp module (SWAP domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J6ELH2
Sequence length 88
Comment (tr|A0A0J6ELH2|A0A0J6ELH2_BREBE) Membrane protein {ECO:0000313|EMBL:KMM21315.1} KW=Complete proteome OX=1393 OS=Brevibacillus brevis (Bacillus brevis). GN=AB432_16570 OC=Brevibacillus.
Sequence
MDRMYRVLGFWTIVIALMAFWAELYPMALIFFSLTAFFVALSYMNLTERVYLNIFFGFMF
LSFVGFTYYTFFVMPVGPQEHALLQLIM
Download sequence
Identical sequences A0A0J6ELH2 J3A6D8
WP_007723294.1.34404 WP_007723294.1.57305 WP_007723294.1.83547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]