SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J6F8H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J6F8H1
Domain Number - Region: 71-147
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0238
Family Capz alpha-1 subunit 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J6F8H1
Sequence length 196
Comment (tr|A0A0J6F8H1|A0A0J6F8H1_COCPO) Uncharacterized protein {ECO:0000313|EMBL:KMM69306.1} KW=Complete proteome OX=454284 OS=Coccidioides posadasii RMSCC 3488. GN=CPAG_05624 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MVQTGEKARKPKGVAGCGGKSQKLVPRVWANQNSPKVLTLVAYRHLRVYYAFSCDGFWRC
PVRYGCARCPVRNPRWLVPRRRQRFLVDDQNSLGGDLEPHVNPEQAGSERLTLQIMQSAS
TTSQFTQYRNMYNPDRFSGVILTSHEILQSTKILRSKQANSQRRVSGYPYAGAAVNIIAT
KAREGEGAQGITKFHA
Download sequence
Identical sequences A0A0J6F8H1
CPAT_05660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]