SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J6FB73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6FB73
Domain Number 1 Region: 3-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-85
Family Capz beta-1 subunit 0.0000000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6FB73
Sequence length 267
Comment (tr|A0A0J6FB73|A0A0J6FB73_COCPO) F-actin-capping protein subunit beta {ECO:0000313|EMBL:KMM70271.1} KW=Complete proteome OX=454284 OS=Coccidioides posadasii RMSCC 3488. GN=CPAG_06583 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MADTQFDSALDLLRRLSPRDTKRNLQYITTLVPDLTEDLLASVDQPLEIRRCRRSQRDYL
LCDYNRDGDSYRSPWSNEFDPPLDDGTVPSERVRKMEVAANEAFDVYRELYFEGGVGSVY
FWDLDDDGFAGVVLLKKGITPGSKNSGAWDSIHVFEATDRGRICHYKLTSTVILHLSTGS
EVLGDMDLSGNMTRQIEADMPIEGDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVS
ELRSIQPLSETNRDRSAHRDMINSMMK
Download sequence
Identical sequences A0A0J6FB73 A0A0J7B4V5 A0A0J8RMX2 A0A0J8TW54 E9DDU6 J3KE69
CIHT_04251 XP_001245328.1.59393 CIRT_04623 CIMG_04769T0 CIST_07001 CPSG_07737T0 CPAT_06625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]