SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6I0B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6I0B1
Domain Number 1 Region: 151-334
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.45e-60
Family Methylesterase CheB, C-terminal domain 0.0000301
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily CheY-like 2.13e-22
Family CheY-related 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J6I0B1
Sequence length 336
Comment (tr|A0A0J6I0B1|A0A0J6I0B1_9PSED) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=122355 OS=Pseudomonas psychrophila. GN=TU76_07410 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MRIAIVNDMPLAVEALRRALAFEPAHQVVWVASDGEEAVRLCAENTPDLILMDLIMPVMD
GVEATRRIMAESPCAIVIVTIDREQNVHRVFEAMGFGALDVVDTPVLGGSNPKEASAPLL
RKILNVGWLMGQSEKRVTPVSAQPRVPGGRGGLVAIGSSAGGPAALETLLKGLPRNFGAA
IVLVQHVDQVFAAGMAEWLSTSCGLDVRLARDGETPQVGTVLLAGTNHHIRLLKNGTLAY
TAEPVNEIYRPSIDVFFESVAQYWSGDAVGVLLTGMGRDGAQGLKSMRQQGFLTIAQDQH
SSSVYGMPKAAAAIDAAVEIRPLDKIAPRLLEKFAK
Download sequence
Identical sequences A0A0J6I0B1 S6I0W9
WP_019822116.1.83801 WP_019822116.1.96099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]