SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J6W813 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6W813
Domain Number 1 Region: 280-540
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.33e-60
Family PFOR Pyr module 0.065
Further Details:      
 
Domain Number 2 Region: 62-266
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.19e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.016
Further Details:      
 
Domain Number 3 Region: 555-658
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.2e-16
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J6W813
Sequence length 684
Comment (tr|A0A0J6W813|A0A0J6W813_9MYCO) 2-oxoglutarate oxidoreductase subunit KorA {ECO:0000313|EMBL:KMO77767.1} KW=Complete proteome OX=1807 OS=Mycobacterium obuense. GN=MOBUDSM44075_01675 OC=Mycobacterium.
Sequence
MTAHRIGGDSMDIRPKPHWSADEKADEKDTEGERVADNGIETGPVSASASGAPRQKLEKV
VIRFAGDSGDGMQLTGDRFTSEAALFGNDLATQPNYPAEIRAPQGTLPGVSSFQIQIADY
DILTAGDRPDVLVAMNPAALKANVSDLPRGGLIIANSDEFTKRNLAKVGYDANPLETDEL
SDYVVQAVAMTTLTLGAVESIGASKKDGQRAKNMFALGLLSWMYGRELEHSEAFIREKFA
RKPEVAEANVLALKAGWNYGETTEAFGTTYEVAPAKLKSGEYRQISGNTALAYGIVTAGQ
LSDLQVVLGTYPITPASDILHELSKHKNFNVLTFQAEDEIAGIGAAIGASYGGAIGVTST
SGPGISLKSEAIGLAVMTELPLLVIDVQRGGPSTGLPTKTEQADLLQAMFGRNGESPVAI
LAPRSPSDCFDIAVEAVRIAINYHTPVMILSDGAIANGSEPWRIPDVSTYEPIEHTFAKE
GEPFQPYARDPETLARQFAVPGTPGLAHRIGGLESANGSGNISYEPKNHDLMVRLRQEKV
AGIDVADLEVDDPTGDADLLLLGWGSSYGPIGEACRRARRKGIKVAHAQLRHLNPFPANL
GEVLGRYSRVVLPEMNLGQLALLLRGQFLVDVQSVTKVEGMAFLADEVEGIIDAALDGTL
AEKENEKATFARLAAATVETGVNA
Download sequence
Identical sequences A0A0J6W813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]