SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6Y018 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J6Y018
Domain Number - Region: 250-279
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 0.0502
Family Bacterial photosystem II reaction centre, L and M subunits 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J6Y018
Sequence length 336
Comment (tr|A0A0J6Y018|A0A0J6Y018_COCIT) Uncharacterized protein {ECO:0000313|EMBL:KMO99887.1} KW=Complete proteome; Reference proteome OX=404692 OS=Coccidioides immitis RMSCC 2394. GN=CIRG_00030 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MVRVASAVVALGAVCFAASEQVFGFKSGPSAPHIPPGLSHGFAPAYSSNKTDKPTQYLMA
GPQLTGYAAASAVNKVPVIPISGDGINCPSNTEPSAKSSDGYQCMYGNAEGTIHLHSALS
KCCYSPQESVFLLSTTGETYHAANYFFDSKYCCVDEGEVDASLTDGMCVYGQSRLTVPTS
YVTKCCWNKKTDSFGVHLRQSVPNIPHVVINKGAKVDIFPDLSAGATVVEANIYQSFMTL
KIMLWLGGAINEHITFTIQVWYSHKWEIARRWQFGTWIPGEVYADFETLIRPDLSIDYKV
HYTGSGIFGRLEATTGPFHIDTPPELKLFLGNLKMC
Download sequence
Identical sequences A0A0J6Y018 A0A0J8RW25 J3KG76
CIHT_06122 CIRT_00030 CIMG_00070T0 XP_001246299.2.59393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]