SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J7EIV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7EIV4
Domain Number 1 Region: 8-88
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 3.66e-31
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00024
Further Details:      
 
Domain Number 2 Region: 83-134
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000108
Family AraC type transcriptional activator 0.01
Further Details:      
 
Domain Number 3 Region: 136-185
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000151
Family AraC type transcriptional activator 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J7EIV4
Sequence length 198
Comment (tr|A0A0J7EIV4|A0A0J7EIV4_BACCE) AraC family transcriptional regulator {ECO:0000313|EMBL:KMP92021.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=TU65_20660 OC=Bacillus cereus group.
Sequence
MHNEGITLTNEHWQAIIHNDSSYDSKFFYAVKSTGIFCRPSCKSRIPNRNNVRIFHHAEQ
ALSENFRPCKRCKPNGITLPNEEWVEQIKDYIEKHFDELLTLDILAEMCHGSPFHLQRTF
KKMTGISPIEYIQQFRIVKAAEQLLQTNQSIKEISTAIGVENPEYFATLFKKKTGFTPTE
YRKKNEMKEGYNNEFLQK
Download sequence
Identical sequences A0A0J7EIV4
WP_048545881.1.1809 WP_048545881.1.51099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]