SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J7HPC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J7HPC1
Domain Number 1 Region: 156-341
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-60
Family Methylesterase CheB, C-terminal domain 0.0000316
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily CheY-like 5.55e-20
Family CheY-related 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J7HPC1
Sequence length 356
Comment (tr|A0A0J7HPC1|A0A0J7HPC1_9BACT) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1008392 OS=Chitinispirillum alkaliphilum. GN=CHISP_2801 OC=Chitinispirillaceae; Chitinispirillum.
Sequence
MIKVLIADKSPQTARYIRDLLSEDEKFSVLNIVNNSSDTIELARSLKPDLLLMDLALPHS
EDGFEVIRVIMETSPLPIVIMSYKETNSQTVNTFNALQAGAVALISKPEDSDPEKRTIEE
SKLKETVRLMSEVKVVTRRRKKSQRDFEIESEIQPKSPLVVIGASTGGPPVLQAILSNLP
ANFPSAILVVQHITEGFVNGLQVWLERTTNKKVLLASHGEKIIPGRVYIAPDNCQMGVDF
EERIVLRDDPPENNIRPSVSYLFRSSCRVYKSALIAVLLTGMGKDGAKEMKQIREYGGIT
IAQDRDSSIVYGMPGAAIEYNAVRYIFDPAQIAQKLPAFTHQILKRIEKGNKDELI
Download sequence
Identical sequences A0A0J7HPC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]