SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8AYX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8AYX7
Domain Number 1 Region: 10-97
Classification Level Classification E-value
Superfamily Barstar-related 1.18e-20
Family Barstar-related 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J8AYX7
Sequence length 109
Comment (tr|A0A0J8AYX7|A0A0J8AYX7_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KMS92867.1} KW=Complete proteome; Reference proteome OX=68263 OS=Streptomyces regensis. GN=ACZ91_01905 OC=Streptomyces.
Sequence
MSEDLTGRIVVALDLDGVTDKAGLMDRAARALSLPDWFGRNWDALADSLSDPSVWPAEAE
GRGLLVVVRGWEGYATERPQEWETAREVFTQAMRVMPSLTVALALGGTS
Download sequence
Identical sequences A0A0J8AYX7
WP_031024998.1.66388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]