SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J8RAM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J8RAM9
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.1e-82
Family Capz alpha-1 subunit 0.00000573
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J8RAM9
Sequence length 273
Comment (tr|A0A0J8RAM9|A0A0J8RAM9_COCIT) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KMU81495.1} KW=Complete proteome; Reference proteome OX=454286 OS=Coccidioides immitis RMSCC 3703. GN=CISG_09165 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MPSNIEIASSFVEGAPPGELNDVVADIKALTSDGPDIINSLEPAFRSYNETQLTTTKLAG
SSQEVIVSSYNRLEDGRYYDVESQTAFEFDHVSQIASAPKSHPLESQNSDLIKSLLKSLS
SHTREHFVSCSYGVYPTDNDSSVTILLVANKYSPNNFWNGRYRTIYHVPISSPTTITGKI
HVDVHYYEDGNVSLNNTKPVSIPIQSTSAETIVRRIAAAEREHQQELNEAFGRLAEGAFK
GLRRQLPITRQKVEWEKVGGYRLGQDIAGGRGQ
Download sequence
Identical sequences A0A0J6Y3Y7 A0A0J8RAM9 A0A0J8U9T1 C5PGK7 E9CWE9 J3KJ44
XP_001247626.1.59393 XP_003065805.1.1890 CIST_09201 CIRT_01490 CIMG_01397T0 CIHT_01645 222929.C5PGK7 CPSG_01782T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]