SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J8RGE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J8RGE3
Domain Number - Region: 67-92
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.0128
Family E6 C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J8RGE3
Sequence length 273
Comment (tr|A0A0J8RGE3|A0A0J8RGE3_COCIT) Cell cycle control protein cwf16 {ECO:0000313|EMBL:KMU83079.1} KW=Complete proteome; Reference proteome OX=396776 OS=Coccidioides immitis H538.4. GN=CIHG_00861 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MSERKVLTKYYPPDFDPSAITRTPKHLRATGPKLLTVRLMAPFSLKCTNCGEYIYKGRKF
NARKETTDERYLNIPIYRFYIRCTRCSSEITFKTDPKNMDYTCERGAKRNFEPWRDAAAS
QVNETEEETLDRLEREENEAEERAQRDKMMELEEKMLDSKREMAVADALDEIRTRNARIE
RGERGGEEAALLRARREAEDAQAKADAEDAEIARRVFMTKDGERVKRLVEESDTGDSPVP
NSAEMPPPSFARVKKPKKPFSAGLGIKKKTSLV
Download sequence
Identical sequences A0A0J6Y4J8 A0A0J8QL98 A0A0J8RGE3 J3K869
XP_001242570.1.59393 CIMG_06466T0 CIST_03449 CIRT_03281 CIHT_00868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]