SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J9BYT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9BYT2
Domain Number 1 Region: 798-1172
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.08e-120
Family PFOR PP module 0.00000000738
Further Details:      
 
Domain Number 2 Region: 3-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.06e-77
Family PFOR Pyr module 0.0000000249
Further Details:      
 
Domain Number 3 Region: 412-664
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-76
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000122
Further Details:      
 
Domain Number 4 Region: 259-410
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.18e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000116
Further Details:      
 
Domain Number 5 Region: 671-839
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.44e-18
Family Ferredoxin domains from multidomain proteins 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J9BYT2
Sequence length 1178
Comment (tr|A0A0J9BYT2|A0A0J9BYT2_9FIRM) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome OX=742734 OS=[Clostridium] citroniae WAL-19142. GN=HMPREF9470_03062 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MARKMKTMDGNHAAAHASYAFTDVAAIFPITPSSPMAEATDEWATDGRTNIFGREVQITE
MQSEAGAAGSVHGALAAGALTTTYTASQGLLLMIPNLYKIAGEQLPGVIQVSARALATHA
LSIFGDHSDVYACRQTGCAMLCESSVQEVMDLTVVAHMAAIKGKVPFINFFDGFRTSHEI
QKIETWDYDELKDMVDMDAIDEFRKNALNPNHPCQRGSAQNPDIFFQAREACNPYYDALP
AIVQEYMDKVNAKIGTDYKLFNYYGAPDAERVIISMGSVNDTIEETIDYMAKQGQKVGVV
KVRLYRPFCAQALIDAIPDTVKVISVLDRTKEPGALGEPLYLDVVAALKGTKFDQVKILT
GRYGLGSKDTTPAQIVAVYENTTKSPFTVGIVDDVTNLSLELGAPLVTTPEGTTNCKFWG
LGADGTVGANKNSIKIIGDNTDMYAQAYFDYDSKKSGGVTMSHLRFGHTPIKSTYLIRKA
DFVACHNPAYVRKYNMVQELVDGGTFLLNCPWDKEGLEKHLPGQVKKFIADHNINFYTID
GVKIGIETGMGPTRINTILQSAFFELTGIIPAEKANELMKAAAKATYGRKGEDVVMKNWA
AIDAGAKGVHKVEVPESWKNCEDEGLDYAVVSHGRKDVVDFVNNIQSKVNAQEGNNLPVS
AFVDYSDGSTPSGSSAYEKRGIAVKVPTWVPENCIQCNFCSYVCPHAVIRPVAMTADEAA
KAPADMKMKDMTGMPGYKFAMTISPLDCTGCGSCANVCPGMKGNKALEMKSLEENLGEAA
AFDFGQSLPVKEEVLAKFKENTVKGSQFKQPLLEFSGACAGCGETPYAKLITQLFGDRMY
IANATGCSSIWGNSSPSTPYTVNSRGQGPAWDNSLFEDNAEFGYGMLLAQNAIRDGLKAK
VEEVMASEQASDEVKAACKEYLDTFGIGALNGSASDKLVAALDGIDCPTCKDIVKNKDFL
AKKSQWVFGGDGWAYDIGFGGVDHVLASGKDINIMVYDTEVYSNTGGQSSKATKTGAVAQ
FAAGGKDTKKKDLAGIAMSYGYVYVAQICMGADMAQTVKAIAEAEAYPGPSLIIAYAPCI
NHGIKKGMDKAQTEEKLAVECGYWNNFRYNPAAEKKFSLDSKPPKMDNYQEFLKGEVRYL
SLTMKNPERAAELFARNEAEAKERYAYLEKLVTLYGND
Download sequence
Identical sequences A0A0F0CG28 A0A0J9BYT2 A0A1C5P2Z7 G5HCQ2
WP_007858569.1.29057 WP_007858569.1.54606 WP_007858569.1.73368 WP_007858569.1.88818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]