SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J9CYL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9CYL9
Domain Number 1 Region: 174-359
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.18e-51
Family Methylesterase CheB, C-terminal domain 0.0000466
Further Details:      
 
Domain Number 2 Region: 20-125
Classification Level Classification E-value
Superfamily CheY-like 3.42e-24
Family CheY-related 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J9CYL9
Sequence length 364
Comment (tr|A0A0J9CYL9|A0A0J9CYL9_SPHYA) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=13690 OS=Sphingobium yanoikuyae (Sphingomonas yanoikuyae). GN=BV87_08025 OC=Sphingomonadaceae; Sphingobium.
Sequence
MTVFVPTMVSLDSHTAPAVRTLVVDDSVVVRTVIERILNADPGFTVVHKTNSAENALRYL
AEHSVDLVLLDIELPGQSGLAALPAILRSNPQGKVAILSGRCEEGSAAAVEALALGASDI
LSKPGSGSFGEQFPQALIDRLGRLFGGEAPTAPAQRSTLVPSAHATSAAVEPLACLGIGA
STGGIHALSQLFGGLTAPLGVPILLTQHLPVSFTVYFAQQLARMTSLRVKVAEAGDLLAP
DTVYVAPGDANLLLRRGLHGRVSVVLDPERTPSGNLPGVDPMFTAMADVYGAGAAGIVLT
GMGRDGTAGARDIVAAGGWIVAQDETSSVVWGMPGSVAGAGLTCALMEPHAIMDFVARRG
KMND
Download sequence
Identical sequences A0A0J9CYL9
WP_048938397.1.50744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]