SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9E0N9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9E0N9
Domain Number 1 Region: 78-273
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.41e-42
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00055
Further Details:      
 
Domain Number 2 Region: 5-77
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 7.59e-17
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J9E0N9
Sequence length 278
Comment (tr|A0A0J9E0N9|A0A0J9E0N9_9RHOB) Chemotaxis protein methyltransferase {ECO:0000256|PIRNR:PIRNR000410} KW=Complete proteome; Reference proteome OX=1675527 OS=Candidatus Rhodobacter lobularis. GN=AIOL_001169 OC=Rhodobacteraceae; Rhodobacter.
Sequence
MEQTQPDAALSEGDFAKLCKIIHQHTGITIGESRKSMLHSRLRPRLRETDEPDFKAYISR
LSEDQSEVQQMINRVTTNETYFYRTPRVWEYFRQEYLPGILSKRSSGTVKVWSGASSTGE
EGHTLGIVLEDQRQAHPGFDYRVVGTDISSRVLETAQNGVYNGRSIARFRKLEPDLFAQH
MHGNDQDGYKVTAEIKSRITFKRHNLIDAQSKDGPFHAVFLRNVLIYFKQEDQEKILAHV
HNAVHPDGILIIGESETLKGMRTQFHQIAPMIYRPGAV
Download sequence
Identical sequences A0A0J9E0N9
WP_049642138.1.18559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]