SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J9R8D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9R8D8
Domain Number 1 Region: 219-396
Classification Level Classification E-value
Superfamily MIR domain 5.49e-39
Family MIR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1090-1220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-20
Family SPRY domain 0.027
Further Details:      
 
Domain Number 3 Region: 669-805
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000514
Family SPRY domain 0.061
Further Details:      
 
Domain Number 4 Region: 102-186
Classification Level Classification E-value
Superfamily MIR domain 0.000000209
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 4197-4259
Classification Level Classification E-value
Superfamily EF-hand 0.000000476
Family Calmodulin-like 0.032
Further Details:      
 
Domain Number 6 Region: 2241-2339
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000379
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J9R8D8
Sequence length 5117
Comment (tr|A0A0J9R8D8|A0A0J9R8D8_DROSI) Uncharacterized protein {ECO:0000313|EMBL:KMY92353.1} OX=7240 OS=Drosophila simulans (Fruit fly). GN=Dsimw501_GD10606 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAEAEGGSEQDDVSFLRTEDMVTLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPDLS
QCVFVIEQALSVRALQELVTAAGSETDSRLGKGTGSGHRTLLYGNAILLRHHNSDMYLAC
LSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLH
TTKENEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWG
REAGQNIVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDSN
ELILVKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLW
LSYKSYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFI
TALETLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDL
FQEEGVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTN
CAQFANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEK
HGRDPKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGR
VDGSSMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYS
FGFDGAYLWTGGRKTLVVDALPEEPFIRKGDVVGVAIDLSVPIITFTFNGVKVRGSFRDF
NLDGMFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGN
LSKNVLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSW
GEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIRPVRL
PNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSE
NHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEAQRLKFA
GFRTYRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNEE
KVYGGVSESFGKQCGPGDIVGVFLDLADHTISFSLNGELLMDALGGETTFADVTAEGVGF
VPACTLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENT
EEMPDCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMGEFISEQEKA
RRWDEIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEA
DHMMRGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPF
KFFSKKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPV
PQGPKQLSGSNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQY
HLHSREFNKNKVRRGSVYIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGM
FVGCFVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLP
LSAAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPV
SMLALHIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQL
LYAIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELKELYSEEEMQHS
LRSLVTESVRPQLRMTEITEPIPDIDQLYSPKFPLEVVRQFVMEALKDAVEINQVHNRDP
IGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAFEREGKDEHRKGLLT
MKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYIEIKQSDLPSA
VAAKKTKEFRCPPREQMNQILCFKNLEPDDQDNCTCGLELRGRLGDFHDSLMQKVSLNAL
QEPDGVEGTAIEEVKTGPITKIYNFINTVKELEEGPKEVEEPEKKTPEEVFRKVLIKTIV
SWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRARDDVAEMWVGLSQIR
ALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMNTLGRRAQAQS
DAPTQTEGAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFDFLLDNANILL
ARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELVEKGYPDLG
WDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLFRAIVEA
NRMSERISDRCKMQDEAEGTIAGLNFTHPLPEGEEDEDYIDTGAAILNFYCTLVDLLGRC
APDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLSQTAPGEEKPKSDMPSGLLP
NNKQSIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGSESDMALAMNRYIGN
SILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQMQP
AMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGASSDEEKRLTM
LLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNTDEDYYGRQMGAPDQPQ
YMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPY
NMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVPLNHRGSTRRQSKPQINEFQNEGS
PFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIHPQLVPYDLL
TDKEKKKDRERSQEFLKYMQYQGYKLHKPSKGGAVEEGGVTQAAVELRFSYSLLEKLIQY
LDRATINMKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRNYFIAIATATN
NIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGIDARTLTKNCPE
FIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVVLPVLTAMFDH
LAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIERHRPALGSCLGAY
SSCFPVAFLEPHLNKHNQYSLLNRIADHSLEAQDIMVKMESCMPNLETILAEVDQFVESD
KTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNHVTMVTADHMNPLLRNVLKMIK
KNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLHKEDSMRGFIK
SATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEELYNHVAEI
FNIWSKSQYFLKEEQNFISANEIDNMALIMPTATRRSAISEGAPAVGGKVKKKKKNRDKK
RDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKMPEYDVIEFARNQLT
LPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKDKTQETVDRIVAMAK
VLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACNIFARSYYEQW
LQEENVGQEVMVEDLTQTFEDSEKSKKEGEETDSKPDPLTQLVTTFCRGAMTERSGALQE
DLLYMSYAQIAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHEQEMEKQKLLFHQARLSNRG
VAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKDVGFFTSIAG
LMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCALFRFIQLTCEGHNLEWQ
NYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGKANFFKAIEVASQ
VFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQ
KDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLADLIESPSFHEV
DMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAFVEHFHEPSKEIG
FNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSKRIERVYFEIKDS
NIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMATDDGGGN
VKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANIKHQIGVMQTKSIP
ELIVGFFKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGPAPEQEEEPVVEEETFGRALPP
LPLEEPPGTVQAFGLDINKEENGMYKVVVHESPANSSMEEGGESSPEDGAAASGELVEGE
PHQEPISIVDLLGGEAAKKAAQERQEAQKAQEAAMASIEAEAKKSSSAPQETPAVHQIDF
SQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTEEADSSAEEELILGSGSG
GGADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHVLRIAACLHSLVSLAMLI
AYYHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWDKLVISAKSFPVNYWDKF
VKKKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETGIFKYIMNIDWRYQVWKAGVTFT
DNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLT
IIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGDPDG
DDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDNMESNCFICGMGKD
FFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRSWDFFPVGD
CFRKQYEDELSGGGGGG
Download sequence
Identical sequences A0A0J9R8D8
XP_016026564.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]