SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J9SFY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9SFY7
Domain Number 1 Region: 24-168
Classification Level Classification E-value
Superfamily MIR domain 2.49e-27
Family MIR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J9SFY7
Sequence length 224
Comment (tr|A0A0J9SFY7|A0A0J9SFY7_PLAVI) Uncharacterized protein {ECO:0000313|EMBL:KMZ80837.1} KW=Complete proteome OX=1077284 OS=Plasmodium vivax India VII. GN=PVIIG_02055 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MSHYRFFVRVFLFSFLFFKVHSCLHVTDGSSIILENVGTSYKLFSTDMKWGSGSGNQLVT
AIKTNKNEENLLWTVNIYDEVKSFTGNKINCDEIVTLKHVKSNGYLMGSSHDSILSNNYE
LSVHQSKESGKFQVICENKKNSPYWSLGENIYLKSVDHNGYVSASKSYEFNQYNCHNCPI
LYHLEACIMRYTYPRDEQKWRAKSGVIITQFNDERGEKFNGDEL
Download sequence
Identical sequences A0A0J9SFY7 A0A0J9SVU1 A0A0J9TF86 A0A0J9WE55 A0A1G4GW53 A5K7D2
gi|156096769|ref|XP_001614418.1| XP_001614418.1.43797 gb|PVX_094755 5855.PVX_094755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]