SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9UDI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J9UDI4
Domain Number - Region: 3-80
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0697
Family Group I mobile intron endonuclease 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J9UDI4
Sequence length 116
Comment (tr|A0A0J9UDI4|A0A0J9UDI4_FUSO4) Uncharacterized protein {ECO:0000313|EMBL:KNA97423.1} OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN=FOXG_18238 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MYRCLQGVLRHGLLHHLTSRLEPLLHCNPRLIYEYFFYFFLSLGYSRFKYVSYSRCLISI
FLRPAMQLIPVPVNNYLNPTLELVNRWTSWRFSYLQWVLHSYFLYKRRQGTSLNSK
Download sequence
Identical sequences A0A0J9UDI4 X0B8X1
XP_018235469.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]