SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9UM00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J9UM00
Domain Number - Region: 29-62
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 0.0536
Family DNA polymerase III psi subunit 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J9UM00
Sequence length 132
Comment (tr|A0A0J9UM00|A0A0J9UM00_FUSO4) Uncharacterized protein {ECO:0000313|EMBL:KNA99927.1} OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN=FOXG_18617 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MSWSATFFFDIALSVEWGWETSCLRREALYHVNQQILSKASWLFQRTLLLMQVSIGQTPL
IPGKLLLFCRVSIYTCFSPWFPGTNNKRRLIGSAPSTRRSPSDTQYIPPAATACHGSTEN
GPGHRVHESTLR
Download sequence
Identical sequences A0A0J9UM00 W9ZSC4
XP_018237973.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]