SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9XGJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9XGJ8
Domain Number 1 Region: 137-245
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 5.36e-30
Family Elongation factor TFIIS domain 2 0.00057
Further Details:      
 
Domain Number 2 Region: 10-84
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 7.59e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00043
Further Details:      
 
Domain Number 3 Region: 271-312
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.45e-16
Family Transcriptional factor domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J9XGJ8
Sequence length 314
Comment (tr|A0A0J9XGJ8|A0A0J9XGJ8_GEOCN) Similar to Saccharomyces cerevisiae YGL043W DST1 General transcription elongation factor TFIIS {ECO:0000313|EMBL:CDO56679.1} OX=1173061 OS=Geotrichum candidum (Oospora lactis) (Dipodascus geotrichum). GN=BN980_GECA16s01275g OC=Saccharomycetes; Saccharomycetales; Dipodascaceae; Galactomyces.
Sequence
MSATATTSLDVSEIKSMMNDLEKSNGSTERIITLLTIFEEKVKPTEKLLRETKLGIAVNK
FRSHGDKKVSELVKRIIKKWKDQVSAQKHKQVKHEKKPSTSTESNASTAKAGASSSSGSA
AAGGKESGKPLFNSNGKARSPENDGVNTNVYPDAVRNSCISLLYKGLAVESTATPNDILT
AAKSVEEAVFIGERGTGAGYKNKIRSLFANLKDPRNPQLRQRVVSGEIAGKRLYTMTPKE
LASDEFKKELEEINKQNLFNAQAAVEKRAITDRFTCSKCKQKKVSYFQMQTRSADEPLTT
FCTCENCGKRWKFS
Download sequence
Identical sequences A0A0J9XGJ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]