SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0J9YHJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9YHJ7
Domain Number 1 Region: 324-513
Classification Level Classification E-value
Superfamily MIR domain 2.09e-49
Family MIR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J9YHJ7
Sequence length 745
Comment (tr|A0A0J9YHJ7|A0A0J9YHJ7_GEOCN) Similar to Saccharomyces cerevisiae YJR143C PMT4 Protein O-mannosyltransferase {ECO:0000313|EMBL:CDO51391.1} OX=1173061 OS=Geotrichum candidum (Oospora lactis) (Dipodascus geotrichum). GN=BN980_GECA01s05477g OC=Saccharomycetes; Saccharomycetales; Dipodascaceae; Galactomyces.
Sequence
MAELRHRQVSKKKSTLAVAPAKTEKLPVDASVPDNLLQEKKTRDQYRLALIIVTALAFFT
RFYIINYPNEVVFDEVHFGKFASYYLQRTYFFDLHPPFAKLLIAAVGWLVGYNGAFKFDN
IGDSYITNKVPYVAYRSLSATLGSLTVPLVFITMQQSGYSIPACVIASSLVLFDNAHVAE
TRLILLDATLIFSVALSFYCYVRFSKERNSPFSFNWWKWLLSTGVALSCVISTKYVGTFT
FATVGTAVLIDLWNLLDFRAGLTLKQFGRHFVARAFSLIVLPFMIFLFWFYVHFAILTNS
GPGDNFMSPEFQETLGENILAKEARQINYYDTVTLKHKDTGILLHSHDARYPLRYDDGRI
SSQGQQVTGYSHRDPNNEWQILPVTDFPEDQREGHSVPAGSTIRLRHVVTNSYLLTHDVA
SPYFPTNQEFTTVDPELANGEKFNYTLFDLRMVSNKAGPLRTKMGVFKLIHVPTKVAMWT
HTKKLPEWGFGQYEVNGNKNVNEGSNNWYFDEITDLTDPERLKHVPKERKTMPFLKKYLE
LQSSMFAQNNALTKEHPYASQPLSWPFLVRGVSFWTKDKDRTQIYFTGNFIGWWLEISFI
AVYLGVLLADQLSRRRNIHALENSARNKLYNSLGFFFIGWATHYFPFFLMGRQKFLHHYL
PAHLAAAYLTGGLFDFIFGEMDIAEKRKKLSQKKNWTYIIATIVVLTLIIGCFLYFSPLT
YGWPGLTVEQIRSRQLMDIELHFSK
Download sequence
Identical sequences A0A0J9YHJ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]