SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0DGT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0DGT5
Domain Number 1 Region: 57-98
Classification Level Classification E-value
Superfamily SAP domain 0.0000000000000321
Family SAP domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K0DGT5
Sequence length 105
Comment (tr|A0A0K0DGT5|A0A0K0DGT5_ANGCA) Uncharacterized protein {ECO:0000313|WBParaSite:ACAC_0001033101-mRNA-1} KW=Complete proteome; Reference proteome OX=6313 OS=Angiostrongylus cantonensis (Rat lungworm). GN= OC=Strongylida; Metastrongyloidea; Angiostrongylidae; Angiostrongylus.
Sequence
MLACFYIGALPESATSIMGDVSKQLSWSMPPEKVCDKLKSKDAQICELKYDKPLDWSKID
LKKMRVKELKNILNEWGEDCKGCTEKSEFVKRIEELKPKFVKEEL
Download sequence
Identical sequences A0A0K0DGT5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]