SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0HNH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0HNH2
Domain Number 1 Region: 1-38
Classification Level Classification E-value
Superfamily Ribosomal protein L36 6.54e-17
Family Ribosomal protein L36 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K0HNH2
Sequence length 38
Comment (tr|A0A0K0HNH2|A0A0K0HNH2_HAFAL) 50S ribosomal protein L36 {ECO:0000256|HAMAP-Rule:MF_00251, ECO:0000256|RuleBase:RU000571} KW=Complete proteome OX=569 OS=Hafnia alvei. GN=BN1044_03120 OC=Hafniaceae; Hafnia.
Sequence
MKVRASVKKLCRNCKIVKRNGVVRVICSVEPKHKQRQG
Download sequence
Identical sequences A0A085H226 A0A097R6X9 A0A0C5W637 A0A0H3DU05 A0A0K0HNH2 A0A1B7KIZ2 A0A261QSF2 A0A2A2MD06 A0A2A7TZI9 E5YLT9
gi|387869025|ref|YP_005700494.1| WP_008815462.1.100673 WP_008815462.1.18854 WP_008815462.1.20341 WP_008815462.1.21026 WP_008815462.1.23521 WP_008815462.1.2790 WP_008815462.1.2897 WP_008815462.1.32191 WP_008815462.1.32312 WP_008815462.1.35652 WP_008815462.1.36219 WP_008815462.1.39507 WP_008815462.1.41100 WP_008815462.1.4146 WP_008815462.1.45880 WP_008815462.1.46293 WP_008815462.1.46376 WP_008815462.1.48059 WP_008815462.1.50131 WP_008815462.1.50384 WP_008815462.1.53416 WP_008815462.1.56080 WP_008815462.1.60063 WP_008815462.1.60554 WP_008815462.1.61771 WP_008815462.1.6255 WP_008815462.1.62958 WP_008815462.1.67501 WP_008815462.1.69651 WP_008815462.1.7078 WP_008815462.1.79796 WP_008815462.1.82304 WP_008815462.1.83294 WP_008815462.1.84595 WP_008815462.1.86133 WP_008815462.1.91532 WP_008815462.1.93107 WP_008815462.1.93273 WP_008815462.1.93403 WP_008815462.1.93598 WP_008815462.1.9424 WP_008815462.1.95158 WP_008815462.1.9786 WP_008815462.1.9917 gi|470464230|ref|YP_007630541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]