SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0ISH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0ISH6
Domain Number 1 Region: 41-84
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000679
Family Ovomucoid domain III-like 0.0055
Further Details:      
 
Domain Number 2 Region: 137-196
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000624
Family Ovomucoid domain III-like 0.0075
Further Details:      
 
Domain Number 3 Region: 84-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000444
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Domain Number 4 Region: 201-250
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000125
Family Ovomucoid domain III-like 0.018
Further Details:      
 
Domain Number 5 Region: 250-301
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000638
Family Ovomucoid domain III-like 0.0071
Further Details:      
 
Domain Number 6 Region: 309-339
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000152
Family Ovomucoid domain III-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K0ISH6
Sequence length 353
Comment (tr|A0A0K0ISH6|A0A0K0ISH6_BRUMA) Uncharacterized protein {ECO:0000313|WBParaSite:Bm11697} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MEKIEHLKLTLLNENGSCSDTSIVNVDKLSQDINESMNCKKDIECDTNYEPICGTDGITY
VNRCRLMKTRCFNKTLLAAYNGECCTNRCEQHWAPVCDNRNITHLNLCMFNVQNCIATRS
VGESLHIVSYAACTNDACNMQCKPNIYQPVCASNGITYQSECELNNVICELNMQNNQWNW
MRNIETKLELDYIGECCEETTGKCDENDNLSPICDSEGHTHNNVCDYERMACLSQRRFQT
NLTIRYWDECCIDDCQREQTQMPLCDNTQTTHENWCKFRLAQCESHRRFKRTLQLAYIGE
CCMISNDDNCTDNNSICDTDGVTHRNLCTFRNKQCIIKRTEQKLINIAYYEIM
Download sequence
Identical sequences A0A0K0ISH6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]