SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0KDT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0KDT0
Domain Number 1 Region: 1-213
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 7.85e-77
Family Spike glycoprotein-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K0KDT0
Sequence length 214
Comment (tr|A0A0K0KDT0|A0A0K0KDT0_9RHAB) Glycoprotein {ECO:0000313|EMBL:AIG21359.1} OX=11292 OS=Rabies lyssavirus. GN= OC=Mononegavirales; Rhabdoviridae; Lyssavirus.
Sequence
DYTIWMPENPRLGTSCDIFTNSKGKRASKGSKTCGFVDERGLYKSLKGACKLKLCGVLGL
RLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTT
KSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSRGCLRVGGRCHP
HVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMEL
Download sequence
Identical sequences A0A0K0KDF8 A0A0K0KDG2 A0A0K0KDL3 A0A0K0KDL9 A0A0K0KDQ4 A0A0K0KDQ7 A0A0K0KDS7 A0A0K0KDT0 A0A0K0KE32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]