SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0QAM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0QAM6
Domain Number 1 Region: 28-182
Classification Level Classification E-value
Superfamily TIMP-like 1.41e-27
Family Tissue inhibitor of metalloproteinases, TIMP 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K0QAM6
Sequence length 184
Comment (tr|A0A0K0QAM6|A0A0K0QAM6_BACTU) Cobalamin biosynthesis protein CbiN {ECO:0000313|EMBL:AKR08905.1} KW=Complete proteome OX=1428 OS=Bacillus thuringiensis. GN=AC241_09295 OC=Bacillus cereus group.
Sequence
MKRILHMFPIIIICSFILIIFPEKSYACDCIKVSTEDAFQKNDVVFEGKVIEVGRKEEVG
TEVLFEVKKIWKGTTSSQIIVYTKGGDCMFRFVEGGEYLVFSTQRGSEKQLHTHSCSGSK
RLDEAGADKSVLSQIAKESVPTKKVDLKGEMVSGLSLWQVAIISMGLLWIIAFVIFIVRK
TRKK
Download sequence
Identical sequences A0A0K0QAM6
WP_050843231.1.13279 WP_050843231.1.74651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]