SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0QSC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0K0QSC9
Domain Number - Region: 25-55
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.0667
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K0QSC9
Sequence length 77
Comment (tr|A0A0K0QSC9|A0A0K0QSC9_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AKR16031.1} KW=Complete proteome OX=1673887 OS=Citrobacter phage IME-CF2. GN= OC=Tevenvirinae; T4virus.
Sequence
MRPYSAPNTSKYVAIVILSTIAMCFVTAIVFGILEMKKEEKRKQEIYDYMDRMCTPLEYG
IDKKPTKYSCENIIFNK
Download sequence
Identical sequences A0A076YME7 A0A0K0QSC9 A0A1B1IXT9 Q56C46
gi|66391453|ref|YP_238978.1| Q56C46_9CAUD YP_009097605.1.16537 YP_009218723.1.99815 YP_009285542.1.86861 YP_238978.1.84042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]