SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K0SHM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0K0SHM0
Domain Number - Region: 65-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0258
Family F93-like 0.083
Further Details:      
 
Domain Number - Region: 14-64
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0497
Family Capz alpha-1 subunit 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K0SHM0
Sequence length 111
Comment (tr|A0A0K0SHM0|A0A0K0SHM0_BACT3) Cell dividion protein FtsZ {ECO:0000313|EMBL:AKR38755.1} KW=Complete proteome OX=180850 OS=Bacillus thuringiensis subsp. indiana. GN=NF53_p5001 OC=Bacillus cereus group.
Sequence
MSSSEIIDVLCENLNDGIWALRVLYAEGAMNKEKLWDYINQYHKEYQIENEKDYEGKKIL
PSRYALDIMTARLEGAGLISFKAIGRVRIYDVTNLGNVLIKELEKRVEKNN
Download sequence
Identical sequences A0A0K0SHM0 A0A243AU43 A0A2B4GMR6 A0A2C3AYZ6 A0A2H3QKB4 C2XLD1
WP_000098928.1.13269 WP_000098928.1.55077 WP_000098928.1.72484 WP_000098928.1.97327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]