SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0TZG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0TZG3
Domain Number 1 Region: 20-167
Classification Level Classification E-value
Superfamily MtlR-like 0.0000994
Family MtlR-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K0TZG3
Sequence length 185
Comment (tr|A0A0K0TZG3|A0A0K0TZG3_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:AKR57135.1} KW=Complete proteome; Reference proteome OX=1643450 OS=Devosia sp. H5989. GN=XM25_15305 OC=Hyphomicrobiaceae; Devosia.
Sequence
MTAGALMSTISPTFGPFEKELTHFLKEMESEDELGVVVRCAIHIEHQVLGFVKDALPNGD
AIDRRDWEYSDLLTLAQACDLSPQVLAPARAIAKIRNQFAHNLDYALDKNASGSLQSTLT
GVPLMSYRAAVKDLYNRKKQGTKIDMDLDRPLDQFKMIAYIVILSVTALRIKATRGTANS
KPATM
Download sequence
Identical sequences A0A0K0TZG3
WP_082202257.1.40586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]