SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K0U362 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0U362
Domain Number 1 Region: 177-364
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.15e-70
Family Methylesterase CheB, C-terminal domain 0.000000651
Further Details:      
 
Domain Number 2 Region: 3-115
Classification Level Classification E-value
Superfamily CheY-like 2.99e-28
Family CheY-related 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K0U362
Sequence length 373
Comment (tr|A0A0K0U362|A0A0K0U362_9RHIZ) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=1643450 OS=Devosia sp. H5989. GN=XM25_21830 OC=Hyphomicrobiaceae; Devosia.
Sequence
MSQKIRVLIVDDSASVRMALSEIIAADPDLEVMATAADPYVAAERIRQEVPDVIFLDIEL
PRMDGLTFLRKIMAQRPIPVVICSSLAQAGSETLMQALEAGAVDVVSKPRVDTAHFLQES
RMRICDAAKAAAHAKLRGVRKAAPALAIEAKLTADAVLPAVSETRRTSLMARLPVTEPIV
AIGASTGGTEALREVLEALPAASPAIVIVQHMPEKFTAAFARRLDASCAVSVREAQDGDA
VVAGSVLIAPGNQHMQLVRNGSRYSVKIVDGPHVSRHRPSVDVLFRSTAQTAGRNAMGIL
LTGMGDDGARGLLEMKQFGSPTIAQDEETSVVFGMPKEAIQRGAAGKVVPLGRVAQEIIG
FARSAPQRIGGAA
Download sequence
Identical sequences A0A0K0U362
WP_049707696.1.40586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]