SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K1ECV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1ECV2
Domain Number 1 Region: 23-208
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-55
Family Methylesterase CheB, C-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 292-488
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.09e-44
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00074
Further Details:      
 
Domain Number 3 Region: 1040-1210
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.99e-43
Family Histidine kinase 0.00071
Further Details:      
 
Domain Number 4 Region: 1232-1353
Classification Level Classification E-value
Superfamily CheY-like 3.27e-29
Family CheY-related 0.0095
Further Details:      
 
Domain Number 5 Region: 846-970
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-16
Family Heme-binding PAS domain 0.032
Further Details:      
 
Domain Number 6 Region: 975-1052
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000589
Family Homodimeric domain of signal transducing histidine kinase 0.001
Further Details:      
 
Domain Number 7 Region: 225-294
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000017
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.012
Further Details:      
 
Domain Number 8 Region: 745-848
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000023
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K1ECV2
Sequence length 1383
Comment (tr|A0A0K1ECV2|A0A0K1ECV2_CHOCO) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=52 OS=Chondromyces crocatus. GN=CMC5_028170 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MSENPSTMLGERPGHASDETTPEFFVVGVGASAGGLEALERLFEGLSPGCGLAFVVVQHL
SPDFDSVMAELLARRTELDCVRVTNGIEVRTDTIYLMPPGTEMIISGGCLLLTERVLDQG
LSLPIDGFFRSLAEDMGSRAAAVILSGSGSDGSRGVRAIHEAGGLVLVQSEETARFDGMP
RSAIDTGIVDLILSPEELRDALIRYAKRPPGSGAEFADLVALSGSGDAMSPIFDLLRRES
GIDFSHYKAATVGRRIERRLLLSRVESPEDYVRQLRDDPAELASLYKDLLIGVTGFFRDR
DAFMRFGTDVLPELLERLGPDEDLRIWCAACATGEEAYSLALLAHEAFRKAGQRVRLKVF
ATDVHRVSLEVAGAGIYPAESLAGLPIELRDRYFTRTSHGDRFQVSPALRSSIVFAHHNV
LRDAPFTRIDFVSCRNLLIYFKPAAQRKAISLFLFGLKAGGVMVLGPSETPGPLSDEFLP
LDQRWKIYRKRRELRITPDLRGQEGGRERGERLLDRRSIQERAITKAQHALLERFTPPSL
LVTPTGELLHSFGGGGRFLAYHDGRPSLNVLDLLDGELKFAVASALKRAGKGDEPAFYER
VPARTPDGSCLVRVSVMALGGAEDNQQLLVTLEPATTQSASPGQDEMPVNMLTQERIETL
EHELRHTQENLQATLEEMETSNEELQATNEELIASNEELQSTNEELQSVNEELYTVNAEY
QAKIAELTELTTDMNHLLESTEVQILFLDKELCIRRLTPKIAETFSLLPQDIGRRIDSFT
HKLRHEGIVRDLEGVLHGAERVEREVQDLRGRHYLLRVLPYRPRQTVEGVVLTLVDLSAL
KDAERELRTSEERARLRGEQMRAILDHAPLSIWVKDRRGNYQIVSRVAAEVLGARADLLI
GESDEGLLPPKLASLRRERDEQVASTREVLRVEEQIEYDGAVRTYLTVRFPLVDTSGEVY
AIAGIAEDITVRKDAEERDRTALKRRDDFLAMLSHELRNPLAAVLNATYTIERSELDTSA
TRSALDVTKRQALHMARLLDDLLDITRITLGKIEIRAEPLDLRKAAEAALQAVQPLVESK
KLQLHVDLEPLPVAVRGDLHRLQQVQSNMLTNAAKFTPAGGRIWLSVRREGNQAVIRVRD
SGVGLPKEDFDRVFELFYQRETTLDRSSGGIGVGLSLVQAVVGLHGGRVSASSDGPGRGS
EFVASFPLWQGQLVASTLRPAASPSASPSVSRPLSIILVEDSDDGREMLEVLLMQDGHTV
TSFCTGAEGAEAIIQQKPDLALVDIGLPEVNGYEVARRVRRACGKDGLYLVALTGYGRPE
DQQAAFDAGFDEHVVKPIRPEILDRVVEGVVTAVSVRERPETAPRHGSDRWSSRPATSDA
NAE
Download sequence
Identical sequences A0A0K1ECV2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]