SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K1XH31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1XH31
Domain Number 1 Region: 20-90
Classification Level Classification E-value
Superfamily YdhA-like 0.00000000000366
Family YdhA-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K1XH31
Sequence length 110
Comment (tr|A0A0K1XH31|A0A0K1XH31_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:AKX60492.1} KW=Complete proteome; Reference proteome OX=1697053 OS=Oblitimonas alkaliphila. GN=AKN88_00400 OC=Pseudomonadaceae; Oblitimonas.
Sequence
MPLLGAASQAAQGDAMVQKIYQCERGLVLPVSYINTQSGGAFAVLQVEGRQIPMQITSSG
SGARYLSINQELRYSWHTKGELGVLSWISSNKKAPEEEQGLLKDCKELLR
Download sequence
Identical sequences A0A0K1XH31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]