SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K2BBP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2BBP9
Domain Number 1 Region: 9-193
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.4e-58
Family Methylesterase CheB, C-terminal domain 0.0000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K2BBP9
Sequence length 199
Comment (tr|A0A0K2BBP9|A0A0K2BBP9_9BURK) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=1262470 OS=Herbaspirillum hiltneri N3. GN=F506_07695 OC=Oxalobacteraceae; Herbaspirillum.
Sequence
MNAIASLDGRIDAVVIGTSAGGVDALSVLLPALPGSSKAAVFVVLHLPRDRPSLLVDIFA
PKCRMAVREASDKEPVEAGTIYFAPPDYHLLIDAGPQLALSSDEPVNFSRPAIDVLFESA
ADEYGERLLGIVLTGGNQDGAAGLQAIRAAGGMTVVQEPETAHVRYMPELALQQGEVDYV
LTLEQIAALLGTLQGKIKK
Download sequence
Identical sequences A0A0K2BBP9
WP_053196326.1.78702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]