SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2BJM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2BJM2
Domain Number 1 Region: 20-103
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 4.84e-32
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.0000805
Further Details:      
 
Domain Number 2 Region: 280-361
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 2.88e-30
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0000287
Further Details:      
 
Domain Number 3 Region: 200-279
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase domain 5.69e-22
Family Methylated DNA-protein cysteine methyltransferase domain 0.00034
Further Details:      
 
Domain Number 4 Region: 98-143
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000261
Family AraC type transcriptional activator 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K2BJM2
Sequence length 365
Comment (tr|A0A0K2BJM2|A0A0K2BJM2_9BURK) 6-O-methylguanine DNA methyltransferase {ECO:0000313|EMBL:AKZ65381.1} KW=Complete proteome OX=1262470 OS=Herbaspirillum hiltneri N3. GN=F506_14215 OC=Oxalobacteraceae; Herbaspirillum.
Sequence
MPTRKTNSSPAVARIAAGLDDQRWQAVTQRDKAADGTFYYAVRTTGVYCRPSCPSRQARR
ENVAFYDTGVQAEQAGFRACKRCKPNEAALGERQAQAIATVCRAIEQAEDLPSLDELAQI
AGMSRFHFHRVFKEKTGVTPKAYAAAQRAQRLRAGLVQGDSVTNAMYDAGFNSSGHFYAE
SSGRLGMTPSAYRAGGSGARIRFAVAQCWLGAILVATTEKGVCAITLGDDPDQLVRDLQD
QFPQAELIGGDAAFEKLVAKVIGFIESPQGDLNLPLDVRGTAFQQRVWQALRDIPAGQRV
TYSDIAGRIGSPTAVRAVASACASNAIAVLIPCHRVVRMDGSLSGYRWGVERKQALLERE
GDGKS
Download sequence
Identical sequences A0A0K2BJM2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]