SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2DFU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2DFU0
Domain Number 1 Region: 6-97
Classification Level Classification E-value
Superfamily YccV-like 1.96e-35
Family YccV-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K2DFU0
Sequence length 109
Comment (tr|A0A0K2DFU0|A0A0K2DFU0_9RHIZ) DNA-binding protein {ECO:0000313|EMBL:ALA18858.1} KW=Complete proteome; Reference proteome OX=1702325 OS=Chelatococcus sp. CO-6. GN=AL346_17420 OC=Chelatococcaceae; Chelatococcus.
Sequence
MKTRSAKFGIGQVVRHRIYPFRGVVFDVDPTFDNTEEWWLAIPEGQRPAKDQPFYHLFAE
NDETEYIAYVSEQNLEPDHSQEPIRHPQVDEIFERTAEGNYRVRYSFDN
Download sequence
Identical sequences A0A0K2DFU0
WP_019402715.1.12725 WP_019402715.1.95677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]