SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K2H519 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2H519
Domain Number 1 Region: 159-347
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.14e-64
Family Methylesterase CheB, C-terminal domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily CheY-like 2.42e-31
Family CheY-related 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2H519
Sequence length 349
Comment (tr|A0A0K2H519|A0A0K2H519_GEOSE) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=272567 OS=Geobacillus stearothermophilus 10. GN=GT50_02310 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MKTIKVLVVDDSAFMRKWISDFLSEHPRLEVIGTARNGREALEKIAALRPDVVTLDVEMP
VMNGLETLQRIMRDHPVPVVMVSSTTTEGAENTIDAMQYGAVDFVAKPSGPISLDLYKVK
DELIGKVLHASEANVAALTAPRRQRPSWRPSFKAAARPQQAIVAIGTSTGGPRALETVLT
QLPPDLAAPVVAVQHMPKGFTTSLANRLDALAAITVKEAEDGEVLQNGTAYIAPGGVHLI
VREEGGALKARFDESPPRAGHRPAVDVLFESLAAIRRCRKIAVIMTGMGSDGTSGLKKLK
ESGNTKAIAEARETAVVFGMPRAAIEAGVVDVIVPLDSIAAAIVQLIGE
Download sequence
Identical sequences A0A0E0TA59 A0A0K2H519
gi|261419441|ref|YP_003253123.1| gi|319766256|ref|YP_004131757.1| 544556.GYMC61_2025 WP_013523409.1.50933 WP_013523409.1.59104 WP_013523409.1.80994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]