SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2IUR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2IUR4
Domain Number 1 Region: 4-76
Classification Level Classification E-value
Superfamily Barstar-related 0.00000196
Family Barstar-related 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K2IUR4
Sequence length 130
Comment (tr|A0A0K2IUR4|A0A0K2IUR4_STEMA) Ribonuclease inhibitor {ECO:0000313|EMBL:ALA85855.1} KW=Complete proteome OX=40324 OS=maltophilia). GN=YH67_06115 OC=Stenotrophomonas maltophilia group.
Sequence
MTRILHIEGASINDIASLYVEINRVFMADEDWQLGASLDALDDLLHGGYGALAGHAIATV
VWRDFAHSRDALGRETTRAWLQSKLAQGGRFNGAAIHAQLTALALGQGQTHFEIVMEIFG
SHPQITLVPG
Download sequence
Identical sequences A0A0K2IUR4
WP_053442716.1.53173 WP_053442716.1.89109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]