SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K2IVN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2IVN6
Domain Number 1 Region: 6-189
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.48e-53
Family Methylesterase CheB, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K2IVN6
Sequence length 191
Comment (tr|A0A0K2IVN6|A0A0K2IVN6_STEMA) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=40324 OS=maltophilia). GN=YH67_09060 OC=Stenotrophomonas maltophilia group.
Sequence
MALPARPAVLVIGASAGGVAALQAVLGALPGTLPVPVLAVLHLPRDRTSRIAEVLAPYCA
LPVREAEDKQPLQPGTVTFAPPDYHLLVEDEGSVALSVDAPVLFSRPAIDPLFDSAAAVF
GGQVLALLLTGASSDGSEGVAAVRAAGGRAWLQCPEEAEASMMPASALQHAGADAVLPLE
LMCRRLKELFA
Download sequence
Identical sequences A0A0K2IVN6 A0A0L8A870
WP_010482610.1.10738 WP_010482610.1.11095 WP_010482610.1.31544 WP_010482610.1.45403 WP_010482610.1.53173 WP_010482610.1.89109 WP_010482610.1.96337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]