SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K2M820 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2M820
Domain Number 1 Region: 155-340
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.97e-65
Family Methylesterase CheB, C-terminal domain 0.00000223
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily CheY-like 5.27e-27
Family CheY-related 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K2M820
Sequence length 341
Comment (tr|A0A0K2M820|A0A0K2M820_CLOBE) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1428454 OS=Clostridium beijerinckii NRRL B-598. GN=X276_01650 OC=Clostridium.
Sequence
MRSIRVLIVDDSIVFREAISRGISTAPNIEVVGKAVDPYDARDKLLELNPDVMICDVQMP
KLNGVEFIKRLLPQYKIPIIVVSSISDVVFDAMDAGAVDFLSKPDARTPNGFEIFINELI
IKIRGAVNVNLSANLGQIKKSGSNRGMEKSVNVRNKVIAIGASTGGTEAIYNLLKNLPKD
IPGIIIVQHIPPVFSKMFADRLNLQTHFTVKEAQTGDTIEPGKVLIAPGDKHMKLKKAAD
KYIVETIQGNKVNGHCPSVDVLFESVAKVASKNAIGVILTGMGHDGAVGLMSMRRAGART
IGQDQKSSVVYGMPKVAFEIGAVEKQVAISNIPSVICDMLK
Download sequence
Identical sequences A0A0K2M820
WP_023975974.1.95078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]