SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K2M8B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0K2M8B7
Domain Number - Region: 113-271
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00602
Family Capz beta-1 subunit 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K2M8B7
Sequence length 319
Comment (tr|A0A0K2M8B7|A0A0K2M8B7_CLOBE) Uncharacterized protein {ECO:0000313|EMBL:ALB44174.1} KW=Complete proteome OX=1428454 OS=Clostridium beijerinckii NRRL B-598. GN=X276_02255 OC=Clostridium.
Sequence
MNSITIPAIKSLSITNKYSDKSLNGDKIIVGTDGNYNYYSYLFWDISSIPTNATVYNAKL
TLFKTDNFYYDTSKKFSISPLYEYFSTYTTYNNSPNYDHYTVINFYPLTDNISVTIDITT
IVSSWVKNSLKNKGIILYGRNEDIFTSFGSVKSSDNYLMPFIIVNYDPYSPNKCLKKECT
NKYSKDCCKKKYNDEYFKDDCCEKYIKICKEELESILFKVCKEACGGNCNPFPSNTSITR
TVRVTGTVAPTSVYYIVVDLQVTRASSGQVNHYYVSDEYDNSLNNTPLPIDKTYNIAVSP
PIQSGDAEDVILYGSYKGF
Download sequence
Identical sequences A0A0K2M8B7
WP_023974295.1.16915 WP_023974295.1.95078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]