SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2NXI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0K2NXI2
Domain Number - Region: 42-97
Classification Level Classification E-value
Superfamily TAFH domain-like 0.00811
Family TAFH domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K2NXI2
Sequence length 194
Comment (tr|A0A0K2NXI2|A0A0K2NXI2_9ENTR) Sec-independent protein translocase protein TatB {ECO:0000256|HAMAP-Rule:MF_00237, ECO:0000256|SAAS:SAAS00028234} KW=Complete proteome OX=1159554 OS=Cronobacter dublinensis subsp. dublinensis LMG 23823. GN=AFK67_01490 OC=Enterobacteriaceae; Cronobacter.
Sequence
MFDIGFGELLLVFIIGLIVLGPQRLPVAVRTVAGWVRALRSLATTVQNELTQELKIQEFQ
ESLKKVEKASIDNLTPELKASMDELREAAESMKRSYNVNDPEKASDEAHTIHNPLVKGNE
AEHQGVTPAKAEHQAQSPAQKPQQDVPHAPATDAAMEPAAAESVHPDAGNNADAAPAPAG
VRKPDAVSTVSDKS
Download sequence
Identical sequences A0A0K2NXI2 K8AK36 K8BMK5
WP_007717156.1.21494 WP_007717156.1.32867 WP_007717156.1.56843 WP_007717156.1.58412 WP_007717156.1.78052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]