SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K2T659 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2T659
Domain Number 1 Region: 175-342
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.4e-48
Family IP3 receptor type 1 binding core, domain 2 0.000000637
Further Details:      
 
Domain Number 2 Region: 2-172
Classification Level Classification E-value
Superfamily MIR domain 1.83e-46
Family MIR domain 0.000000285
Further Details:      
 
Domain Number 3 Region: 980-1093
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.53e-33
Family IP3 receptor type 1 binding core, domain 2 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K2T659
Sequence length 2538
Comment (tr|A0A0K2T659|A0A0K2T659_LEPSM) Uncharacterized protein {ECO:0000313|EMBL:CDW20926.1} OX=72036 OS=Lepeophtheirus salmonis (Salmon louse). GN= OC=Copepoda; Siphonostomatoida; Caligidae; Lepeophtheirus.
Sequence
MDEYKKKQSVFLRYTARASATSATSSKALWEVEVVQHDPCRGGAGQWNSLFRFKHLATGQ
YLAAEIDDDKTYDIMREKLKDPNSNSVYHLVSVPHGNDLASLFELDPTTLTNRADSLVPQ
NSYVRLRHLCTSTWVHSTSIPIDKDEEKPGVMSKVGCATLKEDKEAFAIISVTSREVRDL
DFANDACKVLENVSWKLEKGIISQNERRSLTNLLQDIIYFLANQENEQHRVDPLEVMPSC
NRDRQKLLREQYILKQLFRILQAPFMESDTGEEPLLRIEELSDPRHAPYKYIFRLCYRIL
RLSQKDYRKNQEYIAKHFGFMQKQIGYDILAEDTITALLHNNRKLLEKHIKAAEIETFVR
LVQKNMNTWDSRFLDYLSDLCISNNGAIPVTQELICKSVLSPHNSGILIKTRMSSVDTDD
EQDDGFLDGDKESTITTSTTLSSNSSSVCNPIVILSWGDSKKPLTEIAVSARSGNSEDLA
IIEYYRHQLNLFSNMCLDRQYLAINNLSNHLDIALILKCMEDDTLPFYLRASFCRLMLHM
HVDRDPQEQVKPVQYARLWSEIPLRLSIDDYDNDHSSDSAKEIVRQRFQPTINFVESYLK
NVVDSSWTFSDPEQNKLTFEVVKLARDLIYFGFYSFCGLLRLTKTLLNILDCVSDHEASN
GKLPTGDIDSQGGALRSLSEMGAMLTIFTTGVKPINQRTINNKMITTKKEDNLVMDTKLK
IIDILQFILDVRLDYRISCLLSIFKREFDESERKERIRNCGMRGIDLEGIAAQAEGIFGS
SEECAVLDLDGTGGKTFLRVLLHLGMHDYPPLVSGALKLLFRHFSQRQEVLQAFKQVQLL
VSDSDVKSYKQIKDDLDGLRLLVEKSELWVFKIKSPDSQPPTSTAKDSINNIDDDETHDH
ISLRQENSIGSSSQAIASLNGPSNGDGEVGGGENGGGGILGVNDNNNHIHISGVKSSNST
ENKQKLSLPIGIGPSIDLTQSNNYKTIQEILIRMNRLCIQTGFQYISIKPRKHEQRLLRN
MGVHSVVLDLLQISYEKKEDTMMNELMKLAHEFLQNFCLGNQQNQTLLHKHLELFLTPDL
LEARTMCAIFQDNAVLCHDVNEKVVQHFVHCIESHGRHVQYLRFLQTIVRTENQFIRRCQ
DMVMQEMVNAGEDVLVFYNDKASFNHFVDMMRLERNRMDDSSPLRYHIELVRLLACCTMG
KNVFTEIKCHSLLPLDDIVTMVCHRDTIPEVKDAYVDFLTHCYIDTEVEMKEIYTSNHMW
QLFEKSFLLDMGVVSNSTHDRKHADTALEHYVTNTLMDIITTFFKSPFSDQSTTVQTRQP
IFVQLLGAAFRVSQCSWLTVDQRVNVENCIRTLSEVAKSRGIAIPSDLDIQVTAMFNKAA
MISRQTTSKWMQVARGPKREISSATLHMKMDRTIIEGLQDIVSVLEDHLKPLVQAELSVL
VDILYRPELLFPVGTEARRKCESGGFISRLITHTARLLEEKHDSLCAKILQTLREMMAVD
PEYGEKGDSLRISLLVRYFEKFPLPPMQMSATSNTSIPVSHGPGAKFLKRAQLTLHAIQC
HLDYQGASKLIVDLVIKSSNNTKIFAEVVELGSALLEGGNMDIQKSLYEQLSSGEVSQSF
FKVFHVKMNEAQTEIKSTVVVNTSDIPARTQEEKDPNKVDIEKVVRKRTKCSGGVVLTED
LREELDNAAMATQQAYLSSRVGTVGDDVSLFGLPSITTNLEDLLAEKVDRAKEKEEENRL
SPKIAIMKPILRFLQLLCENHNRRMQNLLRDQHNKTKYNLVSETLILLDVICGSTTGGLG
LLGLYINENNVLLINQILETLTEYCQGPCYENQACIATHESNGLGIITALILNDINPLGK
NRMDLVLELKNNASKLLLAIMESRTSDNENIAEKIIYNMNPRQLVEVACKAYYQETLDED
EEMNEDAVSPKVVGHNIYILCHQLALYNKEIGILLKPNSEIMDLKTCDALRYYYNHTAQI
EIARQDRSLEQIVFPIPEICEYLTEETKIRVFRDSERDAQGSKVSDFFNKIDDMFAEMNW
QKKLRSNPALYWVSRHMSLWSYIIFVINVFVNCIVATFFPFSDSLPNAGPHLSGLIWAFL
LISAAIVITVPSSIAIKCLIMASILRMIVSLGPEFAVSFLGVSIVFFKGIHLVSIMGNMG
TFNKPIKQILFNAELAYNIGYLILCITGLFIHPFFFSILLFDVVYREETLLNVMKSVTRN
GRSILLTAVFAIILVYSFSIVGFIFFRDDFVMDTENLPSVDCSSTHNSDSEEPHDKYSKK
FNENCISTEGTEGKERACESLFMCIVTTMNQGLRNGGGIGDVLRSPSSSETLYPARVIYD
MLFFFVVIIIVLNLIFGVIIDTFADLRSEKQQKEEIIKNSCFICGLERKAFDNKHVTFED
HFHFEHNMWHYLYFIVLIKVKDPTEFTGPESYVHEMVKHRCLEWFPRLKAISLAVEDVDG
EQNEWRSLHNQLEATQGLVQILSSQLTELRDQMTEQRKQKQRMGLLNTTPSLLNLGNGVL
QQQQQHYQQNQALSNDRN
Download sequence
Identical sequences A0A0K2T659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]