SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2TZW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2TZW5
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.75e-48
Family FAT domain of focal adhesion kinase 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K2TZW5
Sequence length 152
Comment (tr|A0A0K2TZW5|A0A0K2TZW5_LEPSM) Uncharacterized protein {ECO:0000313|EMBL:CDW30916.1} OX=72036 OS=Lepeophtheirus salmonis (Salmon louse). GN= OC=Copepoda; Siphonostomatoida; Caligidae; Lepeophtheirus.
Sequence
KPTKTAQLDRTNDSVYEATTNVVRAVMSLSQCVQHQLSSQYLEKVRTVGVELRHLLSSVD
VLVPAFPPLTHRQVEMAHKVLSKDMAELVDSLKLVQKYLNTTVEAEYRRGMLSASHVLAM
DAKNLLDVIDNIRVKYPHVDSHIVRGGIVASG
Download sequence
Identical sequences A0A0K2TZW5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]