SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0K3CNM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K3CNM5
Domain Number 1 Region: 6-149,282-414
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.53e-59
Family Capz alpha-1 subunit 0.0000784
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K3CNM5
Sequence length 421
Comment (tr|A0A0K3CNM5|A0A0K3CNM5_RHOTO) BY PROTMAP: gi|342319067|gb|EGU11019.1| putative F-actin capping [Rhodotorula glutinis ATCC 204091] {ECO:0000313|EMBL:CTR10593.1} KW=Complete proteome OX=5286 OS=Rhodosporidium toruloides (Yeast) (Rhodotorula gracilis). GN=BN2166_0064540 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence
MSDAQARLDAASTFLLQSPPGEVNDVLSDLRAILSSSGLSDSQIESGLLPALTKHNAEQF
TVVESEGKKVLVTPASRIEGASEEEEGTERHVEPREGKEFVFDHLKGLASSASPHTSPFD
AETSTLRISLDQLLSSYVSNHYASGVAAVYTLPDPAYPPPEPAPAAAPSTEETATEPEGT
GETGTIAQDVEGGKEEVADVAADTAEEAEKALPEEGVETVGGEGAEPTGVSAEEAEAGEK
AGEFEFEAVEEDKMDVGTPAAATTAAEEEEAPSATTENAAPVPPQPRPSRLFGLYFVGNK
YNPSNYWTGRWRSTYQLDYAKGTLEGTAQINIHYYEQGNVQLSTTLKSSATLSPSPSPES
VVASIKATESSFQRQLGETYNDLSDASFRGLRRALPNTRSKLDWDKATGMRLGQQIGGGA
Q
Download sequence
Identical sequences A0A0K3CNM5 G0T249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]