SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K6G285 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K6G285
Domain Number 1 Region: 97-202
Classification Level Classification E-value
Superfamily Actin-crosslinking proteins 0.0000000000000103
Family Fascin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K6G285
Sequence length 278
Comment (tr|A0A0K6G285|A0A0K6G285_9HOMO) Protein FRG1 {ECO:0000313|EMBL:CUA72342.1} KW=Complete proteome; Reference proteome OX=456999 OS=Rhizoctonia solani. GN=RSOLAG22IIIB_01009 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MSDKPKSKRLAFKGEKKSKKRKVREVDEEQREDDIDPGTWVQPETPEQVLGPTFIVHDSG
TPTCVAFDSTRNRINIQTLSSASSSSGEPSKPLSIVPTEVHQVWVATRVAGSLTINLRTP
EGRFLSCDALGLVSADREARGPQEEFTPVILPETDEEGNHMVAFKNIYEKYISVDEVAGG
QTTLRGDSETVGFNERFWVRVQYEYKRKAGEEDRKKAGKNRPQEIDEVGANHKFQAWGAG
RSITSAEDSKALKKARKEGTLTEALLDRRIKLKSDRFC
Download sequence
Identical sequences A0A0K6G285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]