SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K6GYY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K6GYY9
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 7.45e-29
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.00028
Further Details:      
 
Domain Number 2 Region: 80-119
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000827
Family Prokaryotic DksA/TraR C4-type zinc finger 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K6GYY9
Sequence length 121
Comment (tr|A0A0K6GYY9|A0A0K6GYY9_9RHIZ) RNA polymerase-binding transcription factor DksA {ECO:0000256|HAMAP-Rule:MF_00926} KW=Complete proteome OX=363953 OS=Chelatococcus sambhunathii. GN=Ga0061061_101105 OC=Chelatococcaceae; Chelatococcus.
Sequence
MNERQRDYFRRKLNAWKDEILRESRETLAALQNESENHPDIADRASSETDRAIELRARDR
QRKLIAKIDAALQRIEDGTYGYCEETGEPISLRRLEARPIATLSLEAQERHERNERVYRD
D
Download sequence
Identical sequences A0A0K6GYY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]