SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K6HCM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K6HCM2
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily FlgN-like 3.14e-20
Family FlgN-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K6HCM2
Sequence length 152
Comment (tr|A0A0K6HCM2|A0A0K6HCM2_9GAMM) Flagellar biosynthesis/type III secretory pathway chaperone {ECO:0000313|EMBL:CUA88612.1} KW=Complete proteome; Reference proteome OX=1381080 OS=Idiomarina woesei. GN=Ga0061064_2272 OC=Idiomarinaceae; Idiomarina.
Sequence
MSLRQHLTAQVERLDQLNALLEQEQKLLGDGKIDGEQLKQLAEQKQTLQHAIETNETKRR
AAQQKLGFSNDAAGAREAAQQADCEDVWQQLLERTQRIAQLNSLNGELIQHRLHHNQQML
NILRDAAGTGGAAIYGADGSQETTPQRLNSKA
Download sequence
Identical sequences A0A0K6HCM2
WP_055439901.1.13059 WP_055439901.1.40899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]