SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K6IJU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K6IJU6
Domain Number 1 Region: 91-161
Classification Level Classification E-value
Superfamily YajQ-like 4.45e-30
Family YajQ-like 0.0000751
Further Details:      
 
Domain Number 2 Region: 2-83
Classification Level Classification E-value
Superfamily YajQ-like 2.35e-28
Family YajQ-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K6IJU6
Sequence length 161
Comment (tr|A0A0K6IJU6|A0A0K6IJU6_9GAMM) UPF0234 protein Ga0061065_103236 {ECO:0000256|HAMAP-Rule:MF_00632} KW=Complete proteome OX=1137284 OS=Marinomonas fungiae. GN=Ga0061065_103236 OC=Oceanospirillaceae; Marinomonas.
Sequence
MPSFDIVSELNWHEVTNAVDQSNREVSTRFDFKGVDASFTVKDKQAVVLEAKAEMQLRQM
MDILGQKLVNRGIDLKTLDRGPIVEGNLRATQEIKLKEGIDQAEAKKIVKMIKDSKIKVQ
AQVQGEQLRVTGKKRDDLQQVMQLLRGAELELPVQFNNFRD
Download sequence
Identical sequences A0A0K6IJU6
WP_055462343.1.58696 WP_055462343.1.78333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]